General Information

  • ID:  hor001896
  • Uniprot ID:  P15438
  • Protein name:  Glucagon-36
  • Gene name:  gcg
  • Organism:  Lithobates catesbeianus (American bullfrog) (Rana catesbeiana)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  Produced in the A cells of the islets of Langerhans in response to a drop in blood sugar concentration.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lithobates (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HSQGTFTSDYSKYLDSRRAQDFVQWLMNSKRSGGIS
  • Length:  36
  • Propeptide:  HSQGTFTSDYSKYLDSRRAQDFVQWLMNSKRSGGISXXHADGTFTSDMSSYLEEKAAKEFVDWLIKGRPKHADGSFTSDFNKALDIKAAQEFLDWIINTPVKE
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level.
  • Mechanism:  X's in the sequence were included by homology with other species sequences.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8N729-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-Q8N729-F1.pdbhor001896_AF2.pdbhor001896_ESM.pdb

Physical Information

Mass: 477899 Formula: C180H274N54O58S
Absent amino acids: CEP Common amino acids: S
pI: 9.93 Basic residues: 6
Polar residues: 15 Hydrophobic residues: 8
Hydrophobicity: -97.5 Boman Index: -10509
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 43.33
Instability Index: 7151.67 Extinction Coefficient cystines: 8480
Absorbance 280nm: 242.29

Literature

  • PubMed ID:  3260236
  • Title:  Isolation of peptide hormones from the pancreas of the bullfrog (Rana catesbeiana). Amino acid sequences of pancreatic polypeptide, oxyntomodulin, and two glucagon-like peptides.